SCOPe 2.07: Domain d3l72r1: 3l72 R:1-69

Lineage for d3l72r1 (3l72 R:1-69)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)

8. Domain d3l72r1: 3l72 R:1-69 [262299]
   Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
   automated match to d3l70e1
   complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72r1

PDB Entry: 3l72, 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound

PDB Compounds: (R:) cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial

SCOPe Domain Sequences for d3l72r1:

Sequence; same for both SEQRES and ATOM records:

>d3l72r1 f.23.12.0 (R:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

Timeline for d3l72r1:

• d3l72r1 first appeared in SCOPe 2.05
  
• d3l72r1 appears in SCOPe 2.06
  
• d3l72r1 appears in the current release, SCOPe 2.08