Lineage for d3l71r2 (3l71 R:70-196)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1782958Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1783038Protein automated matches [190874] (7 species)
    not a true protein
  7. 1783041Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries)
  8. 1783051Domain d3l71r2: 3l71 R:70-196 [262296]
    Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71e1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71s_, d3l71t_, d3l71u_, d3l71w_
    automated match to d3l70e2
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71r2

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (R:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l71r2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71r2 b.33.1.1 (R:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

SCOPe Domain Coordinates for d3l71r2:

Click to download the PDB-style file with coordinates for d3l71r2.
(The format of our PDB-style files is described here.)

Timeline for d3l71r2: