Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein automated matches [190874] (7 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries) |
Domain d3h1je2: 3h1j E:70-196 [262287] Other proteins in same PDB: d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1je1, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_ automated match to d3l70e2 complexed with cdl, fes, gol, hec, hem, pee, plc, sma, unl, uq |
PDB Entry: 3h1j (more details), 3 Å
SCOPe Domain Sequences for d3h1je2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1je2 b.33.1.1 (E:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg ddlvvvg
Timeline for d3h1je2:
View in 3D Domains from other chains: (mouse over for more information) d3h1ja1, d3h1ja2, d3h1jb1, d3h1jb2, d3h1jc1, d3h1jc2, d3h1jd1, d3h1jd2, d3h1jf_, d3h1jg_, d3h1jh_, d3h1jj_, d3h1jn1, d3h1jn2, d3h1jo1, d3h1jo2, d3h1jp1, d3h1jp2, d3h1jq1, d3h1jq2, d3h1jr1, d3h1jr2, d3h1js_, d3h1jt_, d3h1ju_, d3h1jw_ |