Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [259353] (2 PDB entries) |
Domain d3gr8a_: 3gr8 A: [262281] automated match to d3gr7a_ complexed with btb, fmn, so4 |
PDB Entry: 3gr8 (more details), 2.5 Å
SCOPe Domain Sequences for d3gr8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gr8a_ c.1.4.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]} mntmlfspytirgltlknrivmspmcmyscdtkdgavrtwhkihyparavgqvgliivea tgvtpqgriserdlgiwsddhiaglrelvglvkehgaaigiqlahagrksqvpgeiiaps avpfddssptpkemtkadieetvqafqngarrakeagfdvieihaahgylineflsplsn rrqdeyggspenryrflgevidavrevwdgplfvrisasdyhpdgltakdyvpyakrmke qgvdlvdvssgaivparmnvypgyqvpfaelirreadiptgavglitsgwqaeeilqngr adlvflgrellrnpywpyaaarelgakisapvqyergwrf
Timeline for d3gr8a_: