Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Thrombin [50531] (2 species) |
Domain d1toc.4: 1toc G:,H: [26228] Other proteins in same PDB: d1tocr1, d1tocr2, d1tocs1, d1tocs2, d1toct1, d1toct2, d1tocu1, d1tocu2 |
PDB Entry: 1toc (more details), 3.1 Å
SCOPe Domain Sequences for d1toc.4:
Sequence; same for both SEQRES and ATOM records: (download)
>g1toc.4 b.47.1.2 (G:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} adcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcgas lisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpryn wkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwtts vaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvm kspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs
Timeline for d1toc.4:
View in 3D Domains from other chains: (mouse over for more information) d1toc.1, d1toc.1, d1toc.1, d1toc.1, d1toc.2, d1toc.2, d1toc.2, d1toc.2, d1toc.3, d1toc.3, d1toc.3, d1toc.3, d1tocr1, d1tocr1, d1tocr2, d1tocr2, d1tocs1, d1tocs1, d1tocs2, d1tocs2, d1toct1, d1toct1, d1toct2, d1toct2, d1tocu1, d1tocu1, d1tocu2, d1tocu2 |