Lineage for d1toc.1 (1toc A:,B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60693Protein Thrombin [50531] (2 species)
  7. 60694Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
  8. 60723Domain d1toc.1: 1toc A:,B: [26225]
    Other proteins in same PDB: d1tocr1, d1tocr2, d1tocs1, d1tocs2, d1toct1, d1toct2, d1tocu1, d1tocu2

Details for d1toc.1

PDB Entry: 1toc (more details), 3.1 Å

PDB Description: structure of serine proteinase

SCOP Domain Sequences for d1toc.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1toc.1 b.47.1.2 (A:,B:) Thrombin {Cow (Bos taurus)}
adcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpryn
wkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwtts
vaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvm
kspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOP Domain Coordinates for d1toc.1:

Click to download the PDB-style file with coordinates for d1toc.1.
(The format of our PDB-style files is described here.)

Timeline for d1toc.1: