SCOPe 2.05: Domain d2znva_: 2znv A:

Lineage for d2znva_ (2znv A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.1: JAB1/MPN domain [102713] (6 proteins)
   Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)

6. Protein automated matches [267675] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [267818] (2 PDB entries)

8. Domain d2znva_: 2znv A: [262244]
   Other proteins in same PDB: d2znvb_, d2znvc_, d2znve_, d2znvf_
   automated match to d3rzuc_
   complexed with edo, zn

Details for d2znva_

PDB Entry: 2znv, 1.6 Å

PDB Description: crystal structure of human amsh-lp dub domain in complex with lys63- linked ubiquitin dimer

PDB Compounds: (A:) AMSH-like protease

SCOPe Domain Sequences for d2znva_:

Sequence; same for both SEQRES and ATOM records:

>d2znva_ c.97.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glrcvvlpedlchkflqlaesntvrgiatcgilcgklthneftithvivpkqsagpdycd
menveelfnvqdqhdlltlgwihthptqtaflssvdlhthcsyqlmlpeaiaivcspkhk
dtgifrltnagmlevsackkkgfhphtkeprlfsickhvlvkdikiivldlr

Timeline for d2znva_:

• d2znva_ is new in SCOPe 2.05-stable
  
• d2znva_ appears in SCOPe 2.06
  
• d2znva_ appears in the current release, SCOPe 2.08