![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) ![]() |
![]() | Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
![]() | Protein automated matches [267675] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [267818] (2 PDB entries) |
![]() | Domain d2znva_: 2znv A: [262244] Other proteins in same PDB: d2znvb_, d2znvc_, d2znve_, d2znvf_ automated match to d3rzuc_ complexed with edo, zn |
PDB Entry: 2znv (more details), 1.6 Å
SCOPe Domain Sequences for d2znva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2znva_ c.97.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} glrcvvlpedlchkflqlaesntvrgiatcgilcgklthneftithvivpkqsagpdycd menveelfnvqdqhdlltlgwihthptqtaflssvdlhthcsyqlmlpeaiaivcspkhk dtgifrltnagmlevsackkkgfhphtkeprlfsickhvlvkdikiivldlr
Timeline for d2znva_: