Lineage for d2o7hb_ (2o7h B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039540Protein GCN4 [57961] (2 species)
  7. 3039541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 3039599Domain d2o7hb_: 2o7h B: [262221]
    Other proteins in same PDB: d2o7ha3, d2o7hd2
    automated match to d2o7ha_

Details for d2o7hb_

PDB Entry: 2o7h (more details), 1.86 Å

PDB Description: crystal structure of trimeric coiled coil gcn4 leucine zipper
PDB Compounds: (B:) General control protein GCN4

SCOPe Domain Sequences for d2o7hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o7hb_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkqledkveellsknyhlenrvarleklvg

SCOPe Domain Coordinates for d2o7hb_:

Click to download the PDB-style file with coordinates for d2o7hb_.
(The format of our PDB-style files is described here.)

Timeline for d2o7hb_: