Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (2 families) |
Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
Protein GCN4 [57961] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries) Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
Domain d2o7hb_: 2o7h B: [262221] Other proteins in same PDB: d2o7ha3, d2o7hd2 automated match to d2o7ha_ |
PDB Entry: 2o7h (more details), 1.86 Å
SCOPe Domain Sequences for d2o7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o7hb_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mkqledkveellsknyhlenrvarleklvg
Timeline for d2o7hb_: