Lineage for d2j3sa3 (2j3s A:2045-2135)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039672Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)
  8. 2039684Domain d2j3sa3: 2j3s A:2045-2135 [262211]
    Other proteins in same PDB: d2j3sa4, d2j3sb2, d2j3sb4
    automated match to d2j3sa1
    complexed with br, dio, gol

Details for d2j3sa3

PDB Entry: 2j3s (more details), 2.5 Å

PDB Description: crystal structure of the human filamin a ig domains 19 to 21
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2j3sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j3sa3 b.1.18.0 (A:2045-2135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcrv
tycptepgnyiinikfadqhvpgspfsvkvt

SCOPe Domain Coordinates for d2j3sa3:

Click to download the PDB-style file with coordinates for d2j3sa3.
(The format of our PDB-style files is described here.)

Timeline for d2j3sa3: