SCOPe 2.05: Domain d2hzga1: 2hzg A:2-128

Lineage for d2hzga1 (2hzg A:2-128)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [255225] (1 PDB entry)

8. Domain d2hzga1: 2hzg A:2-128 [262208]
   Other proteins in same PDB: d2hzga2, d2hzgb2
   automated match to d2hzgb1
   complexed with gol, na

Details for d2hzga1

PDB Entry: 2hzg, 2.02 Å

PDB Description: crystal structure of predicted mandelate racemase from rhodobacter sphaeroides

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily

SCOPe Domain Sequences for d2hzga1:

Sequence; same for both SEQRES and ATOM records:

>d2hzga1 d.54.1.0 (A:2-128) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
slkidavdlfylsmpevtdaadgsqdallvrvaagghigwgeceaaplpsiaafvcpksh
gvcrpvsdsvlgqrldgpddiariaalvgynsmdllqaphmlsgiemalwdllgrrlsap
awallgy

Timeline for d2hzga1:

• d2hzga1 is new in SCOPe 2.05-stable
  
• d2hzga1 appears in SCOPe 2.06
  
• d2hzga1 appears in the current release, SCOPe 2.08