SCOPe 2.08: Domain d4wymb1: 4wym B:1-147

Lineage for d4wymb1 (4wym B:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d4wymb1: 4wym B:1-147 [262165]
   Other proteins in same PDB: d4wyma2, d4wymb2, d4wymc2, d4wymd2, d4wyme2, d4wymf2, d4wymg2, d4wymh2, d4wymj2, d4wymk2
   automated match to d2m8lb1

Details for d4wymb1

PDB Entry: 4wym, 2.6 Å

PDB Description: structural basis of hiv-1 capsid recognition by cpsf6

PDB Compounds: (B:) capsid protein p24

SCOPe Domain Sequences for d4wymb1:

Sequence, based on SEQRES records:

>d4wymb1 a.73.1.1 (B:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d4wymb1 a.73.1.1 (B:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvgqmreprgsdiagttstlqeqigwmthnppipvg
eiykrwiilglnkivrmysp

Timeline for d4wymb1:

• d4wymb1 first appeared in SCOPe 2.04
  
• d4wymb1 appears in SCOPe 2.07