SCOPe 2.06: Domain d4wyma2: 4wym A:148-220

Lineage for d4wyma2 (4wym A:148-220)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (10 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (3 PDB entries)

8. Domain d4wyma2: 4wym A:148-220 [262159]
   Other proteins in same PDB: d4wyma1, d4wymb1, d4wymc1, d4wymd1, d4wyme1, d4wymf1, d4wymg1, d4wymh1, d4wymi1, d4wymj1, d4wymk1, d4wyml1
   automated match to d2m8pa2

Details for d4wyma2

PDB Entry: 4wym, 2.6 Å

PDB Description: structural basis of hiv-1 capsid recognition by cpsf6

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4wyma2:

Sequence, based on SEQRES records:

>d4wyma2 a.28.3.0 (A:148-220) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqg

Sequence, based on observed residues (ATOM records):

>d4wyma2 a.28.3.0 (A:148-220) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqnaatetllvqnanpdcktilkalgpgatlee
mmtacqg

Timeline for d4wyma2:

• d4wyma2 first appeared in SCOPe 2.04
  
• d4wyma2 appears in SCOPe 2.05
  
• d4wyma2 appears in SCOPe 2.07
  
• d4wyma2 appears in the current release, SCOPe 2.08