SCOPe 2.04: Domain d4wwoa3: 4wwo A:545-725

Lineage for d4wwoa3 (4wwo A:545-725)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (57 PDB entries)

8. Domain d4wwoa3: 4wwo A:545-725 [262152]
   Other proteins in same PDB: d4wwoa1, d4wwoa2, d4wwoa4
   automated match to d1e7ua1
   complexed with 3vd, so4

Details for d4wwoa3

PDB Entry: 4wwo, 2.3 Å

PDB Description: crystal structure of human pi3k-gamma in complex with phenylquinoline inhibitor n-{(1s)-1-[8-chloro-2-(3-fluorophenyl)quinolin-3-yl]ethyl}- 9h-purin-6-amine

PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4wwoa3:

Sequence; same for both SEQRES and ATOM records:

>d4wwoa3 a.118.1.6 (A:545-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
g

Timeline for d4wwoa3:

• d4wwoa3 is new in SCOPe 2.04-stable
  
• d4wwoa3 appears in SCOPe 2.05
  
• d4wwoa3 appears in the current release, SCOPe 2.08