Lineage for d4wumd1 (4wum D:1-235)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627154Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1627408Protein automated matches [226868] (2 species)
    not a true protein
  7. 1627409Species Freesia hybrid [TaxId:867926] [261021] (1 PDB entry)
  8. 1627413Domain d4wumd1: 4wum D:1-235 [262138]
    Other proteins in same PDB: d4wuma2, d4wumb2, d4wumd2
    automated match to d1cmla1

Details for d4wumd1

PDB Entry: 4wum (more details), 1.77 Å

PDB Description: x-ray crystal structure of chalcone synthase from freesia hybrida
PDB Compounds: (D:) chalcone synthase

SCOPe Domain Sequences for d4wumd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wumd1 c.95.1.2 (D:1-235) automated matches {Freesia hybrid [TaxId: 867926]}
mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierp

SCOPe Domain Coordinates for d4wumd1:

Click to download the PDB-style file with coordinates for d4wumd1.
(The format of our PDB-style files is described here.)

Timeline for d4wumd1: