Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein automated matches [226868] (2 species) not a true protein |
Species Freesia hybrid [TaxId:867926] [261021] (1 PDB entry) |
Domain d4wumd1: 4wum D:1-235 [262138] Other proteins in same PDB: d4wuma2, d4wumb2, d4wumd2 automated match to d1cmla1 |
PDB Entry: 4wum (more details), 1.77 Å
SCOPe Domain Sequences for d4wumd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wumd1 c.95.1.2 (D:1-235) automated matches {Freesia hybrid [TaxId: 867926]} mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierp
Timeline for d4wumd1:
View in 3D Domains from other chains: (mouse over for more information) d4wuma1, d4wuma2, d4wumb1, d4wumb2 |