Lineage for d4wumb1 (4wum B:1-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917278Protein automated matches [226868] (6 species)
    not a true protein
  7. 2917282Species Freesia hybrid [TaxId:867926] [261021] (1 PDB entry)
  8. 2917284Domain d4wumb1: 4wum B:1-235 [262135]
    Other proteins in same PDB: d4wuma2, d4wumb2, d4wumc2, d4wumd2
    automated match to d1cmla1

Details for d4wumb1

PDB Entry: 4wum (more details), 1.77 Å

PDB Description: x-ray crystal structure of chalcone synthase from freesia hybrida
PDB Compounds: (B:) chalcone synthase

SCOPe Domain Sequences for d4wumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wumb1 c.95.1.2 (B:1-235) automated matches {Freesia hybrid [TaxId: 867926]}
mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierp

SCOPe Domain Coordinates for d4wumb1:

Click to download the PDB-style file with coordinates for d4wumb1.
(The format of our PDB-style files is described here.)

Timeline for d4wumb1: