SCOPe 2.05: Domain d4wuma1: 4wum A:1-235

Lineage for d4wuma1 (4wum A:1-235)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein automated matches [226868] (2 species)
   not a true protein

7. Species Freesia hybrid [TaxId:867926] [261021] (1 PDB entry)

8. Domain d4wuma1: 4wum A:1-235 [262132]
   Other proteins in same PDB: d4wuma2, d4wumb2, d4wumc2, d4wumd2
   automated match to d1cmla1

Details for d4wuma1

PDB Entry: 4wum, 1.77 Å

PDB Description: x-ray crystal structure of chalcone synthase from freesia hybrida

PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d4wuma1:

Sequence; same for both SEQRES and ATOM records:

>d4wuma1 c.95.1.2 (A:1-235) automated matches {Freesia hybrid [TaxId: 867926]}
mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierp

Timeline for d4wuma1:

• d4wuma1 first appeared in SCOPe 2.04
  
• d4wuma1 appears in SCOPe 2.06
  
• d4wuma1 appears in the current release, SCOPe 2.08