Lineage for d4wo4d2 (4wo4 D:126-252)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763347Domain d4wo4d2: 4wo4 D:126-252 [262130]
    Other proteins in same PDB: d4wo4a1, d4wo4a2, d4wo4b_, d4wo4c1, d4wo4d1
    automated match to d3of6b2
    complexed with jls

Details for d4wo4d2

PDB Entry: 4wo4 (more details), 2.5 Å

PDB Description: the molecular bases of delta/alpha beta t cell-mediated antigen recognition.
PDB Compounds: (D:) TCR variable BETA 2 (TRVB20) chain and TCR constant BETA

SCOPe Domain Sequences for d4wo4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wo4d2 b.1.1.2 (D:126-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

SCOPe Domain Coordinates for d4wo4d2:

Click to download the PDB-style file with coordinates for d4wo4d2.
(The format of our PDB-style files is described here.)

Timeline for d4wo4d2: