Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d4wo4d2: 4wo4 D:126-252 [262130] Other proteins in same PDB: d4wo4a1, d4wo4a2, d4wo4b_, d4wo4c1, d4wo4d1 automated match to d3of6b2 complexed with jls |
PDB Entry: 4wo4 (more details), 2.5 Å
SCOPe Domain Sequences for d4wo4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wo4d2 b.1.1.2 (D:126-252) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgra
Timeline for d4wo4d2: