SCOPe 2.04: Domain d4wo4d1: 4wo4 D:1-125

Lineage for d4wo4d1 (4wo4 D:1-125)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4wo4d1: 4wo4 D:1-125 [262127]
   Other proteins in same PDB: d4wo4c2, d4wo4d2
   automated match to d3of6c1
   complexed with jls

Details for d4wo4d1

PDB Entry: 4wo4, 2.5 Å

PDB Description: the molecular bases of delta/alpha beta t cell-mediated antigen recognition.

PDB Compounds: (D:) TCR variable BETA 2 (TRVB20) chain and TCR constant BETA

SCOPe Domain Sequences for d4wo4d1:

Sequence; same for both SEQRES and ATOM records:

>d4wo4d1 b.1.1.0 (D:1-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gavvsqhpsrvisksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeq
gvekdkflinhasltlstltvtsahpedssfyicsapggvgaffgqgtrltvved

Timeline for d4wo4d1:

• d4wo4d1 is new in SCOPe 2.04-stable
  
• d4wo4d1 appears in SCOPe 2.05
  
• d4wo4d1 appears in the current release, SCOPe 2.08