SCOPe 2.03: Domain d1ett.1: 1ett L:,H:

Lineage for d1ett.1 (1ett L:,H:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
   Uniprot P00734 333-622

8. Domain d1ett.1: 1ett L:,H: [26210]
   complexed with 0zg

Details for d1ett.1

PDB Entry: 1ett, 2.5 Å

PDB Description: refined 2.3 angstroms x-ray crystal structure of bovine thrombin complexes formed with the benzamidine and arginine-based thrombin inhibitors napap, 4-tapap and mqpa: a starting point for improving antithrombotics

PDB Compounds: (H:) epsilon-thrombin, (L:) epsilon-thrombin

SCOPe Domain Sequences for d1ett.1:

Sequence; same for both SEQRES and ATOM records:

>g1ett.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

Timeline for d1ett.1:

• d1ett.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ett.1 appears in SCOPe 2.02
  
• d1ett.1 appears in SCOPe 2.04
  
• d1ett.1 appears in the current release, SCOPe 2.08