SCOPe 2.05: Domain d4wfgd1: 4wfg D:1-106

Lineage for d4wfgd1 (4wfg D:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4wfgd1: 4wfg D:1-106 [262059]
   Other proteins in same PDB: d4wfgd2, d4wfgf2
   automated match to d3gnml1
   complexed with ca, tl

Details for d4wfgd1

PDB Entry: 4wfg, 3 Å

PDB Description: Human TRAAK K+ channel in a Tl+ bound conductive conformation

PDB Compounds: (D:) anti-traak antibody 13e9 fab fragment light chain

SCOPe Domain Sequences for d4wfgd1:

Sequence; same for both SEQRES and ATOM records:

>d4wfgd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelk

Timeline for d4wfgd1:

• d4wfgd1 first appeared in SCOPe 2.04
  
• d4wfgd1 appears in SCOPe 2.06
  
• d4wfgd1 appears in the current release, SCOPe 2.08