SCOPe 2.08: Domain d4w6xb1: 4w6x B:6-124

Lineage for d4w6xb1 (4w6x B:6-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4w6xb1: 4w6x B:6-124 [262055]
   Other proteins in same PDB: d4w6xb2, d4w6xb3
   automated match to d1zmya1

Details for d4w6xb1

PDB Entry: 4w6x, 1.88 Å

PDB Description: co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf7

PDB Compounds: (B:) Nanobody NbFedF7

SCOPe Domain Sequences for d4w6xb1:

Sequence; same for both SEQRES and ATOM records:

>d4w6xb1 b.1.1.1 (B:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgggsvqaggslrlsctasgytyrkycmgwfrqapgkeregvacinsgggtsyyadsvk
grftisqdnakdtvflrmnslkpedtaiyycalssnsvcppghvawyndwgqgtqvtvs

Timeline for d4w6xb1:

• d4w6xb1 first appeared in SCOPe 2.04, called d4w6xb_
  
• d4w6xb1 appears in SCOPe 2.07