Lineage for d4v3dd_ (4v3d D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938500Protein Endothelial protein C receptor [75381] (1 species)
    phospholipid-binding protein
  7. 2938501Species Human (Homo sapiens) [TaxId:9606] [75382] (4 PDB entries)
  8. 2938506Domain d4v3dd_: 4v3d D: [262046]
    automated match to d1lqvb_
    complexed with nag, pty

Details for d4v3dd_

PDB Entry: 4v3d (more details), 2.65 Å

PDB Description: the cidra domain from hb3var03 pfemp1 bound to endothelial protein c receptor
PDB Compounds: (D:) Endothelial protein C receptor

SCOPe Domain Sequences for d4v3dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v3dd_ d.19.1.1 (D:) Endothelial protein C receptor {Human (Homo sapiens) [TaxId: 9606]}
qrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqsg
lqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfrp
eralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkh

SCOPe Domain Coordinates for d4v3dd_:

Click to download the PDB-style file with coordinates for d4v3dd_.
(The format of our PDB-style files is described here.)

Timeline for d4v3dd_: