SCOPe 2.05: Domain d4v0ne_: 4v0n E:

Lineage for d4v0ne_ (4v0n E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255698] (5 PDB entries)

8. Domain d4v0ne_: 4v0n E: [262043]
   automated match to d2gaoa1
   complexed with gtp, hg, mg

Details for d4v0ne_

PDB Entry: 4v0n, 3.13 Å

PDB Description: crystal structure of bbs1n in complex with arl6dn, soaked with mercury

PDB Compounds: (E:) arf-like small gtpase

SCOPe Domain Sequences for d4v0ne_:

Sequence; same for both SEQRES and ATOM records:

>d4v0ne_ c.37.1.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
skkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgag
ryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpv
amppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls

Timeline for d4v0ne_:

• d4v0ne_ first appeared in SCOPe 2.04
  
• d4v0ne_ is called d4v0ne1 in SCOPe 2.06
  
• d4v0ne_ appears in the current release, SCOPe 2.08, called d4v0ne1