Lineage for d4ur8c_ (4ur8 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573103Species Agrobacterium tumefaciens [TaxId:358] [262022] (3 PDB entries)
  8. 1573113Domain d4ur8c_: 4ur8 C: [262041]
    automated match to d3pb2a_
    complexed with ccu, fmt

Details for d4ur8c_

PDB Entry: 4ur8 (more details), 2.1 Å

PDB Description: Crystal structure of keto-deoxy-D-galactarate dehydratase complexed with 2-oxoadipic acid
PDB Compounds: (C:) keto-deoxy-d-galactarate dehydratase

SCOPe Domain Sequences for d4ur8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ur8c_ c.1.10.0 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
r

SCOPe Domain Coordinates for d4ur8c_:

Click to download the PDB-style file with coordinates for d4ur8c_.
(The format of our PDB-style files is described here.)

Timeline for d4ur8c_: