Lineage for d4ur7b_ (4ur7 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573103Species Agrobacterium tumefaciens [TaxId:358] [262022] (3 PDB entries)
  8. 1573105Domain d4ur7b_: 4ur7 B: [262034]
    automated match to d3pb2a_
    complexed with fmt, gol

Details for d4ur7b_

PDB Entry: 4ur7 (more details), 1.5 Å

PDB Description: Crystal structure of keto-deoxy-D-galactarate dehydratase complexed with pyruvate
PDB Compounds: (B:) keto-deoxy-d-galactarate dehydratase

SCOPe Domain Sequences for d4ur7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ur7b_ c.1.10.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfxdgtgdiglvrqita
kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
rkawshpqfe

SCOPe Domain Coordinates for d4ur7b_:

Click to download the PDB-style file with coordinates for d4ur7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ur7b_: