SCOPe 2.04: Domain d4um8c2: 4um8 C:439-594

Lineage for d4um8c2 (4um8 C:439-594)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.0: automated matches [233856] (1 protein)
   not a true family

6. Protein automated matches [233857] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233858] (5 PDB entries)

8. Domain d4um8c2: 4um8 C:439-594 [262021]
   Other proteins in same PDB: d4um8a1, d4um8c1
   automated match to d1m1xa1
   complexed with ca, cac, cl, mg, nag, ni, so4

Details for d4um8c2

PDB Entry: 4um8, 2.85 Å

PDB Description: crystal structure of alpha v beta 6

PDB Compounds: (C:) Integrin alpha-V

SCOPe Domain Sequences for d4um8c2:

Sequence, based on SEQRES records:

>d4um8c2 b.1.15.0 (C:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahill

Sequence, based on observed residues (ATOM records):

>d4um8c2 b.1.15.0 (C:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitifme
yrldyrtattglqpilnqftpanisrqahill

Timeline for d4um8c2:

• d4um8c2 is new in SCOPe 2.04-stable
  
• d4um8c2 appears in SCOPe 2.05
  
• d4um8c2 appears in the current release, SCOPe 2.08