Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Brucella abortus [TaxId:1104320] [261997] (1 PDB entry) |
Domain d4u83d1: 4u83 D:1-226 [262008] Other proteins in same PDB: d4u83a2, d4u83a3, d4u83b2, d4u83b3, d4u83c2, d4u83c3, d4u83d2, d4u83d3 automated match to d3nf4a1 complexed with edo |
PDB Entry: 4u83 (more details), 1.8 Å
SCOPe Domain Sequences for d4u83d1:
Sequence, based on SEQRES records: (download)
>d4u83d1 e.6.1.0 (D:1-226) automated matches {Brucella abortus [TaxId: 1104320]} mlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapeewggs dldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacgewigg faltepqagsdasalktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgis afivptdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgae
>d4u83d1 e.6.1.0 (D:1-226) automated matches {Brucella abortus [TaxId: 1104320]} mlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapeewggs dldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacgewigg falteplktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgisafivptdt pgyevmsvehklgqhssdtcalgftnmrvpvenrlgae
Timeline for d4u83d1: