Lineage for d4u83a1 (4u83 A:1-226)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246275Species Brucella abortus [TaxId:1104320] [261997] (1 PDB entry)
  8. 2246276Domain d4u83a1: 4u83 A:1-226 [262003]
    Other proteins in same PDB: d4u83a2, d4u83a3, d4u83b2, d4u83b3, d4u83c2, d4u83c3, d4u83d2, d4u83d3
    automated match to d3nf4a1
    complexed with edo

Details for d4u83a1

PDB Entry: 4u83 (more details), 1.8 Å

PDB Description: structure of brucella abortus butyryl-coa dehydrogenase
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4u83a1:

Sequence, based on SEQRES records: (download)

>d4u83a1 e.6.1.0 (A:1-226) automated matches {Brucella abortus [TaxId: 1104320]}
mlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapeewggs
dldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacgewigg
faltepqagsdasalktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgis
afivptdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgae

Sequence, based on observed residues (ATOM records): (download)

>d4u83a1 e.6.1.0 (A:1-226) automated matches {Brucella abortus [TaxId: 1104320]}
mlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapeewggs
dldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacgewigg
falteplktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgisafivptdt
pgyevmsvehklgqhssdtcalgftnmrvpvenrlgae

SCOPe Domain Coordinates for d4u83a1:

Click to download the PDB-style file with coordinates for d4u83a1.
(The format of our PDB-style files is described here.)

Timeline for d4u83a1: