Lineage for d4ty6a_ (4ty6 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545860Protein Coagulation factor XI [117237] (1 species)
  7. 1545861Species Human (Homo sapiens) [TaxId:9606] [117238] (27 PDB entries)
    Uniprot P03951 388-624
  8. 1545870Domain d4ty6a_: 4ty6 A: [261993]
    automated match to d1xxda_
    complexed with 39d, edo, so4

Details for d4ty6a_

PDB Entry: 4ty6 (more details), 1.85 Å

PDB Description: factor xia in complex with the inhibitor 4-{2-[(1s)-1-({[trans-4- (aminomethyl)cyclohexyl]carbonyl}amino)-2-phenylethyl]-1h-imidazol-4- yl}benzamide
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d4ty6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ty6a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d4ty6a_:

Click to download the PDB-style file with coordinates for d4ty6a_.
(The format of our PDB-style files is described here.)

Timeline for d4ty6a_: