SCOPe 2.04: Domain d4rv4a_: 4rv4 A:

Lineage for d4rv4a_ (4rv4 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (23 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [259286] (2 PDB entries)

8. Domain d4rv4a_: 4rv4 A: [261976]
   automated match to d3oscb_
   complexed with peg, prp

Details for d4rv4a_

PDB Entry: 4rv4, 2.65 Å

PDB Description: 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp)

PDB Compounds: (A:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d4rv4a_:

Sequence, based on SEQRES records:

>d4rv4a_ c.61.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
snamkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleel
ikehfptveviagtatagiahaawvsdrmdlpmcyvrskakghgkgnqiegkaekgqkvv
vvedlistggsaitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysal
tevaaekgiigqaetkklqewrknpadeawita

Sequence, based on observed residues (ATOM records):

>d4rv4a_ c.61.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
snamkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleel
ikehfptveviagtatagiahaawvsdrmdlpmcyvrqiegkaekgqkvvvvedlistgg
saitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysaltevaaekgii
gqaetkklqewrknpadeawita

Timeline for d4rv4a_:

• d4rv4a_ is new in SCOPe 2.04-stable
  
• d4rv4a_ appears in SCOPe 2.05
  
• d4rv4a_ appears in the current release, SCOPe 2.08, called d4rv4a1