SCOPe 2.08: Domain d4rora2: 4ror A:146-320

Lineage for d4rora2 (4ror A:146-320)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Methylobacterium extorquens [TaxId:419610] [261962] (3 PDB entries)

8. Domain d4rora2: 4ror A:146-320 [261963]
   Other proteins in same PDB: d4rora1
   automated match to d3p7ma2
   complexed with ca

Details for d4rora2

PDB Entry: 4ror, 1.66 Å

PDB Description: crystal structure of malate dehydrogenase from methylobacterium extorquens

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4rora2:

Sequence; same for both SEQRES and ATOM records:

>d4rora2 d.162.1.0 (A:146-320) automated matches {Methylobacterium extorquens [TaxId: 419610]}
gvldsarfrhflaeefgvsvedvtafvlgghgddmvpltrystvagvpltdlvklgwttq
ekldamvertrkgggeivnllktgsafyapaasaiamaesylrdkkrvlpcaayldgqyg
idglyvgvpvvigengvervlevtfnddekamfeksvnsvkglieacksvndkla

Timeline for d4rora2:

• d4rora2 first appeared in SCOPe 2.04
  
• d4rora2 appears in SCOPe 2.07