SCOPe 2.08: Domain d4ropa2: 4rop A:143-428

Lineage for d4ropa2 (4rop A:143-428)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:269084] [261952] (2 PDB entries)

8. Domain d4ropa2: 4rop A:143-428 [261953]
   Other proteins in same PDB: d4ropa1
   automated match to d2xsxa2
   complexed with ca, cl, mg

Details for d4ropa2

PDB Entry: 4rop, 2.05 Å

PDB Description: crystal structure of enolase from synechococcus elongatus

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d4ropa2:

Sequence; same for both SEQRES and ATOM records:

>d4ropa2 c.1.11.0 (A:143-428) automated matches {Synechococcus elongatus [TaxId: 269084]}
anvlpvpmmnvinggahadnnvdfqefmimpvgapsfkealrwgaevfhalakvlkdkgl
atgvgdeggfapnlgsnkealellltaieaagykpgeqvalamdvassefyknglytcdg
vshepagmigiladlvsqypivsiedglqeddwsnwktltqqlgstvqlvgddlfvtnpd
rlqsgieqgvgnavliklnqigtltetlrtidlatrsgyrsvishrsgetedttiadlav
atragqiktgslsrseriakynrllrieaalgenalyagaiglgpk

Timeline for d4ropa2:

• d4ropa2 first appeared in SCOPe 2.04
  
• d4ropa2 appears in SCOPe 2.07