SCOPe 2.08: Domain d4rc5b_: 4rc5 B:

Lineage for d4rc5b_ (4rc5 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.6: PMT1231-like [158402] (2 proteins)
   PfamB PB016165
   automatically mapped to Pfam PF11266

6. Protein automated matches [261918] (5 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [261919] (8 PDB entries)

8. Domain d4rc5b_: 4rc5 B: [261942]
   automated match to d4kvqa_
   complexed with fe2, pl3

Details for d4rc5b_

PDB Entry: 4rc5, 2.3 Å

PDB Description: crystal structure of cyanobacterial aldehyde-deformylating oxygenase

PDB Compounds: (B:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4rc5b_:

Sequence; same for both SEQRES and ATOM records:

>d4rc5b_ a.25.1.6 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]}
ldfqsesykdaysrinaiviegeqeafdnynrlaemlpdqrdelhklakmeqrhmkgfma
cgknlsvtpdmgfaqkfferlhenfkaaaaegkvvtclliqsliiecfaiaayniyipva
dafarkitegvvrdeylhrnfgeewlkanfdaskaeleeanrqnlplvwlmlnevaddar
elgmereslvedfmiaygealenigfttreimrmsayglaav

Timeline for d4rc5b_:

• d4rc5b_ first appeared in SCOPe 2.04
  
• d4rc5b_ appears in SCOPe 2.07