SCOPe 2.08: Domain d4rc6a_: 4rc6 A:

Lineage for d4rc6a_ (4rc6 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.6: PMT1231-like [158402] (2 proteins)
   PfamB PB016165
   automatically mapped to Pfam PF11266

6. Protein automated matches [261918] (5 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [261919] (8 PDB entries)

8. Domain d4rc6a_: 4rc6 A: [261937]
   automated match to d4kvqa_
   complexed with fe2; mutant

Details for d4rc6a_

PDB Entry: 4rc6, 2.9 Å

PDB Description: crystal structure of cyanobacterial aldehyde-deformylating oxygenase 122f mutant

PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4rc6a_:

Sequence; same for both SEQRES and ATOM records:

>d4rc6a_ a.25.1.6 (A:) automated matches {Synechococcus elongatus [TaxId: 1140]}
qsesykdaysrinaiviegeqeafdnynrlaemlpdqrdelhklakmeqrhmkgfmacgk
nlsvtpdmgfaqkfferlhenfkaaaaegkvvtclliqsliiecfaiaafniyipvadaf
arkitegvvrdeylhrnfgeewlkanfdaskaeleeanrqnlplvwlmlnevaddarelg
mereslvedfmiaygealenigfttreimrmsayg

Timeline for d4rc6a_:

• d4rc6a_ first appeared in SCOPe 2.04
  
• d4rc6a_ appears in SCOPe 2.07