Lineage for d4r9tb1 (4r9t B:72-288)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002936Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 3002937Protein automated matches [190726] (1 species)
    not a true protein
  7. 3002938Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries)
  8. 3003025Domain d4r9tb1: 4r9t B:72-288 [261926]
    Other proteins in same PDB: d4r9tb2
    automated match to d2j1ge_
    complexed with act, ca, so4

Details for d4r9tb1

PDB Entry: 4r9t (more details), 2.25 Å

PDB Description: l-ficolin complexed to sulphates
PDB Compounds: (B:) ficolin-2

SCOPe Domain Sequences for d4r9tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r9tb1 d.171.1.0 (B:72-288) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcltgprtckdlldrghflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrvdgsvdfy
rdwatykqgfgsrlgefwlgndnihaltaqgtselrvdlvdfednyqfakyrsfkvadea
ekynlvlgafvegsagdsltfhnnqsfstkdqdndlntgncavmfqgawwyknchvsnln
grylrgthgsfanginwksgkgynysykvsemkvrpa

SCOPe Domain Coordinates for d4r9tb1:

Click to download the PDB-style file with coordinates for d4r9tb1.
(The format of our PDB-style files is described here.)

Timeline for d4r9tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r9tb2