Lineage for d4pfna_ (4pfn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867832Species Plasmodium vivax [TaxId:126793] [261543] (5 PDB entries)
  8. 1867841Domain d4pfna_: 4pfn A: [261884]
    automated match to d3ou5a_
    complexed with cl, plp, ser

Details for d4pfna_

PDB Entry: 4pfn (more details), 2.5 Å

PDB Description: crystal structure of plasmodium vivax shmt with l-serine schiff base
PDB Compounds: (A:) Serine hydroxymethyltransferase, putative

SCOPe Domain Sequences for d4pfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pfna_ c.67.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d4pfna_:

Click to download the PDB-style file with coordinates for d4pfna_.
(The format of our PDB-style files is described here.)

Timeline for d4pfna_: