Lineage for d4pfnc_ (4pfn C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614736Species Plasmodium vivax [TaxId:126793] [261543] (3 PDB entries)
  8. 1614744Domain d4pfnc_: 4pfn C: [261880]
    automated match to d3ou5a_
    complexed with cl, plp, ser

Details for d4pfnc_

PDB Entry: 4pfn (more details), 2.5 Å

PDB Description: crystal structure of plasmodium vivax shmt with l-serine schiff base
PDB Compounds: (C:) Serine hydroxymethyltransferase, putative

SCOPe Domain Sequences for d4pfnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pfnc_ c.67.1.0 (C:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d4pfnc_:

Click to download the PDB-style file with coordinates for d4pfnc_.
(The format of our PDB-style files is described here.)

Timeline for d4pfnc_: