Lineage for d4p86b_ (4p86 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610777Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1610778Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1610779Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1611082Protein automated matches [190074] (9 species)
    not a true protein
  7. 1611083Species Bacillus subtilis [TaxId:1423] [261868] (1 PDB entry)
  8. 1611085Domain d4p86b_: 4p86 B: [261873]
    automated match to d1a3ca_
    complexed with 5gp, gol

Details for d4p86b_

PDB Entry: 4p86 (more details), 1.93 Å

PDB Description: Structure of PyrR protein from Bacillus subtilis with GMP
PDB Compounds: (B:) Bifunctional protein PyrR

SCOPe Domain Sequences for d4p86b_:

Sequence, based on SEQRES records: (download)

>d4p86b_ c.61.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
vgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdalvd
vgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyene

Sequence, based on observed residues (ATOM records): (download)

>d4p86b_ c.61.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
vgeiditlyrddltsndeplvkgadipvditdqkvilvddvlytgrtvragmdalvdvgr
pssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyene

SCOPe Domain Coordinates for d4p86b_:

Click to download the PDB-style file with coordinates for d4p86b_.
(The format of our PDB-style files is described here.)

Timeline for d4p86b_: