SCOPe 2.06: Domain d4omob1: 4omo B:85-140

Lineage for d4omob1 (4omo B:85-140)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (14 PDB entries)

8. Domain d4omob1: 4omo B:85-140 [261853]
   Other proteins in same PDB: d4omoa2, d4omob2
   automated match to d1e6ga_
   complexed with epe, ni; mutant

Details for d4omob1

PDB Entry: 4omo, 1.04 Å

PDB Description: Crystal structure of the c-Src tyrosine kinase SH3 domain mutant Q128E

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4omob1:

Sequence, based on SEQRES records:

>d4omob1 b.34.2.0 (B:85-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgetgyipsnyvaps

Sequence, based on observed residues (ATOM records):

>d4omob1 b.34.2.0 (B:85-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivntegdwwlahslttgetgyipsnyvaps

Timeline for d4omob1:

• d4omob1 first appeared in SCOPe 2.04, called d4omob_
  
• d4omob1 was called d4omob_ in SCOPe 2.05
  
• d4omob1 appears in SCOPe 2.07
  
• d4omob1 appears in the current release, SCOPe 2.08