Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (13 species) not a true protein |
Species Goat (Capra hircus) [TaxId:9925] [257696] (2 PDB entries) |
Domain d4omxa_: 4omx A: [261851] automated match to d4nlja_ complexed with arf, so4, ure |
PDB Entry: 4omx (more details), 2.3 Å
SCOPe Domain Sequences for d4omxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omxa_ b.60.1.1 (A:) automated matches {Goat (Capra hircus) [TaxId: 9925]} iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq clvrtpevdkealekfdkalkalpmhirlafnptqlegqchv
Timeline for d4omxa_: