Lineage for d4omxa_ (4omx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804787Species Goat (Capra hircus) [TaxId:9925] [257696] (2 PDB entries)
  8. 2804788Domain d4omxa_: 4omx A: [261851]
    automated match to d4nlja_
    complexed with arf, so4, ure

Details for d4omxa_

PDB Entry: 4omx (more details), 2.3 Å

PDB Description: Crystal structure of goat beta-lactoglobulin (trigonal form)
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d4omxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omxa_ b.60.1.1 (A:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevdkealekfdkalkalpmhirlafnptqlegqchv

SCOPe Domain Coordinates for d4omxa_:

Click to download the PDB-style file with coordinates for d4omxa_.
(The format of our PDB-style files is described here.)

Timeline for d4omxa_: