Lineage for d4o99a2 (4o99 A:271-393)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1882254Species Ralstonia eutropha [TaxId:381666] [261827] (2 PDB entries)
  8. 1882256Domain d4o99a2: 4o99 A:271-393 [261838]
    automated match to d4dd5a2
    complexed with gol

Details for d4o99a2

PDB Entry: 4o99 (more details), 1.96 Å

PDB Description: crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4o99a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o99a2 c.95.1.0 (A:271-393) automated matches {Ralstonia eutropha [TaxId: 381666]}
tplatiksyanagvdpkvmgmgpvpaskralsraewtpqdldlmeineafaaqalavhqq
mgwdtskvnvnggaiaighpigasgcrilvtllhemkrrdakkglaslcigggmgvalav
erk

SCOPe Domain Coordinates for d4o99a2:

Click to download the PDB-style file with coordinates for d4o99a2.
(The format of our PDB-style files is described here.)

Timeline for d4o99a2: