SCOPe 2.08: Domain d4o0ia2: 4o0i A:469-876

Lineage for d4o0ia2 (4o0i A:469-876)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [226972] (9 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [261825] (1 PDB entry)

8. Domain d4o0ia2: 4o0i A:469-876 [261826]
   Other proteins in same PDB: d4o0ia1, d4o0ia3
   automated match to d4dqqa2
   protein/DNA complex; complexed with gol, na, so4

Details for d4o0ia2

PDB Entry: 4o0i, 2.2 Å

PDB Description: crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d4o0ia2:

Sequence; same for both SEQRES and ATOM records:

>d4o0ia2 e.8.1.1 (A:469-876) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

Timeline for d4o0ia2:

• d4o0ia2 first appeared in SCOPe 2.04
  
• d4o0ia2 appears in SCOPe 2.07