![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [255224] (2 PDB entries) |
![]() | Domain d4o0ia1: 4o0i A:298-468 [261824] Other proteins in same PDB: d4o0ia2, d4o0ia3 automated match to d4dqqd1 protein/DNA complex; complexed with gol, na, so4 |
PDB Entry: 4o0i (more details), 2.2 Å
SCOPe Domain Sequences for d4o0ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o0ia1 c.55.3.0 (A:298-468) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d4o0ia1: