Lineage for d4o0ia1 (4o0i A:298-468)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495097Species Geobacillus stearothermophilus [TaxId:1422] [255224] (2 PDB entries)
  8. 2495099Domain d4o0ia1: 4o0i A:298-468 [261824]
    Other proteins in same PDB: d4o0ia2, d4o0ia3
    automated match to d4dqqd1
    protein/DNA complex; complexed with gol, na, so4

Details for d4o0ia1

PDB Entry: 4o0i (more details), 2.2 Å

PDB Description: crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d4o0ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o0ia1 c.55.3.0 (A:298-468) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d4o0ia1:

Click to download the PDB-style file with coordinates for d4o0ia1.
(The format of our PDB-style files is described here.)

Timeline for d4o0ia1: