Lineage for d4nd5c1 (4nd5 C:18-164)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579368Protein automated matches [226881] (6 species)
    not a true protein
  7. 1579369Species Cryptosporidium parvum [TaxId:353152] [261793] (5 PDB entries)
  8. 1579379Domain d4nd5c1: 4nd5 C:18-164 [261798]
    Other proteins in same PDB: d4nd5a2, d4nd5b2, d4nd5c2, d4nd5d2
    automated match to d2ewda1

Details for d4nd5c1

PDB Entry: 4nd5 (more details), 2.1 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum
PDB Compounds: (C:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd5c1:

Sequence, based on SEQRES records: (download)

>d4nd5c1 c.2.1.5 (C:18-164) automated matches {Cryptosporidium parvum [TaxId: 353152]}
ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
igtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvicit
npldvmvshfqkvsglphnkvcgma

Sequence, based on observed residues (ATOM records): (download)

>d4nd5c1 c.2.1.5 (C:18-164) automated matches {Cryptosporidium parvum [TaxId: 353152]}
ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
igtndyadisgsdvviitallfgnarildsvaegvkkycpnafvicitnpldvmvshfqk
vsglphnkvcgma

SCOPe Domain Coordinates for d4nd5c1:

Click to download the PDB-style file with coordinates for d4nd5c1.
(The format of our PDB-style files is described here.)

Timeline for d4nd5c1: