Lineage for d4czpa_ (4czp A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333414Protein automated matches [190089] (9 species)
    not a true protein
  7. 2333447Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)
  8. 2333451Domain d4czpa_: 4czp A: [261770]
    automated match to d1mnpa_
    complexed with ca, gol, hem, mn

Details for d4czpa_

PDB Entry: 4czp (more details), 1.9 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from ceriporiopsis subvermispora in complex with manganese (anomalous data)
PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czpa_ a.93.1.1 (A:) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
ptavcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgps
agggadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncp
gaprvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiara
dkvdptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdt
glmrlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvp
vpkpavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfs
gpatdsp

SCOPe Domain Coordinates for d4czpa_:

Click to download the PDB-style file with coordinates for d4czpa_.
(The format of our PDB-style files is described here.)

Timeline for d4czpa_: