Lineage for d3htc.1 (3htc L:,H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795761Protein Thrombin [50531] (2 species)
  7. 2795797Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2795925Domain d3htc.1: 3htc L:,H: [26175]
    Other proteins in same PDB: d3htci_
    CA-atoms only

Details for d3htc.1

PDB Entry: 3htc (more details), 2.3 Å

PDB Description: the structure of a complex of recombinant hirudin and human alpha-thrombin
PDB Compounds: (H:) alpha-thrombin (large subunit), (L:) alpha-thrombin (small subunit)

SCOPe Domain Sequences for d3htc.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g3htc.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
gsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspqe
llcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiy
ihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlk
etwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegds
ggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

SCOPe Domain Coordinates for d3htc.1:

Click to download the PDB-style file with coordinates for d3htc.1.
(The format of our PDB-style files is described here.)

Timeline for d3htc.1: