Lineage for d4by4a_ (4by4 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1490393Protein automated matches [190064] (20 species)
    not a true protein
  7. 1490415Species Drosophila melanogaster [TaxId:7227] [258881] (2 PDB entries)
  8. 1490420Domain d4by4a_: 4by4 A: [261748]
    automated match to d2lcpa_
    complexed with ca, na

Details for d4by4a_

PDB Entry: 4by4 (more details), 2.3 Å

PDB Description: Crystal structure of Drosophila Frq2
PDB Compounds: (A:) fi18190p1

SCOPe Domain Sequences for d4by4a_:

Sequence, based on SEQRES records: (download)

>d4by4a_ a.39.1.5 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]}
sklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfa
slvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyniv
daiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqals

Sequence, based on observed residues (ATOM records): (download)

>d4by4a_ a.39.1.5 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]}
sklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfa
slvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyniv
daiyqmvgqntpqkrvdkifdqmdknhddrltleefregskadprmvqals

SCOPe Domain Coordinates for d4by4a_:

Click to download the PDB-style file with coordinates for d4by4a_.
(The format of our PDB-style files is described here.)

Timeline for d4by4a_: