Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (20 species) not a true protein |
Species Drosophila melanogaster [TaxId:7227] [258881] (2 PDB entries) |
Domain d4by4a_: 4by4 A: [261748] automated match to d2lcpa_ complexed with ca, na |
PDB Entry: 4by4 (more details), 2.3 Å
SCOPe Domain Sequences for d4by4a_:
Sequence, based on SEQRES records: (download)
>d4by4a_ a.39.1.5 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]} sklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfa slvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyniv daiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqals
>d4by4a_ a.39.1.5 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]} sklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfa slvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyniv daiyqmvgqntpqkrvdkifdqmdknhddrltleefregskadprmvqals
Timeline for d4by4a_: