SCOPe 2.05: Domain d4r51b1: 4r51 B:2-127,B:330-348

Lineage for d4r51b1 (4r51 B:2-127,B:330-348)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries)
   Uniprot Q8DQ00 2-127,330-357

8. Domain d4r51b1: 4r51 B:2-127,B:330-348 [261739]
   Other proteins in same PDB: d4r51a2, d4r51b2
   automated match to d2gyya1
   complexed with act, edo, na, nap, pht

Details for d4r51b1

PDB Entry: 4r51, 1.81 Å

PDB Description: crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid

PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4r51b1:

Sequence; same for both SEQRES and ATOM records:

>d4r51b1 c.2.1.3 (B:2-127,B:330-348) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvr

Timeline for d4r51b1:

• d4r51b1 first appeared in SCOPe 2.04
  
• d4r51b1 appears in SCOPe 2.06
  
• d4r51b1 appears in the current release, SCOPe 2.08