SCOPe 2.08: Domain d4omna1: 4omn A:85-140

Lineage for d4omna1 (4omn A:85-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries)

8. Domain d4omna1: 4omn A:85-140 [261737]
   Other proteins in same PDB: d4omna2
   automated match to d2w10b_
   complexed with gol, peg, pge, so4; mutant

Details for d4omna1

PDB Entry: 4omn, 1.5 Å

PDB Description: Crystal structure of the intertwined dimer of the c-Src tyrosine kinase SH3 domain mutant Q128E

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4omna1:

Sequence; same for both SEQRES and ATOM records:

>d4omna1 b.34.2.0 (A:85-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgetgyipsnyvaps

Timeline for d4omna1:

• d4omna1 first appeared in SCOPe 2.04, called d4omna_
  
• d4omna1 appears in SCOPe 2.07